Protein Info for Echvi_4477 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 74 to 390 (317 residues), 147.9 bits, see alignment E=1.7e-47 PF25973: BSH_CzcB" amino acids 95 to 239 (145 residues), 35.4 bits, see alignment E=1.2e-12 PF25954: Beta-barrel_RND_2" amino acids 249 to 318 (70 residues), 33.8 bits, see alignment E=4.7e-12

Best Hits

KEGG orthology group: None (inferred from 74% identity to zpr:ZPR_4081)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G6N3 at UniProt or InterPro

Protein Sequence (407 amino acids)

>Echvi_4477 RND family efflux transporter, MFP subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKQIIYILALVLIVSVFTACESNSADKAGEASHEAHNEGGHEEEGHNEEGMAEVHLSNL
KFESLGIKIDTIPTRSLSGVVEANGQLEVPPQHEATVTAILGANVNSIKVIEGDKVRKGQ
VLAYLSHPNLTNLQTNYVKAYSRFQYLEKEMQRQKRLYEEEVGSGKTYQETLADYNSMKG
EVKGYEAQLKQLNLNIENIQGGDIYEYVPVVSPIKGYVEKVKVQLGQYVDPQTVMFMIVN
IDHIHADLMVFEKDVHKVKKGQKLSFTVESVPGNTLTAKIYSVGKQFEQKPKAVHVHAEI
DQKEDFLIPGMYINGKIRTGNTQVKALPESAIIEEEGKPYIFMAEAHEEDGKTEWAFKAV
EVRTGINEDGWVEIKLLEPLPDGTQVAWNNAYYLISEMKKSQTSHSH