Protein Info for Echvi_4469 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details PF02308: MgtC" amino acids 13 to 128 (116 residues), 120.9 bits, see alignment E=2.1e-39

Best Hits

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 88% identity to gfo:GFO_1199)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G354 at UniProt or InterPro

Protein Sequence (142 amino acids)

>Echvi_4469 Uncharacterized membrane protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MDFQTEITLIPRLLVALVLGVLIGLDREIDGHAAGIRTYAAVCLGAALVTIINSHIEVAD
QTRIVANIVSGIGFLGAGIIFRDGSKNFISGLTTAATIWVTAAVGIAIGYGMYLIVSVTS
ALLILLLISQHFPFLKKKNIRK