Protein Info for Echvi_4411 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF00106: adh_short" amino acids 47 to 232 (186 residues), 177.6 bits, see alignment E=4.1e-56 PF01370: Epimerase" amino acids 50 to 229 (180 residues), 24.6 bits, see alignment E=3.2e-09 PF08659: KR" amino acids 50 to 210 (161 residues), 41.1 bits, see alignment E=3.8e-14 PF13561: adh_short_C2" amino acids 57 to 284 (228 residues), 175.7 bits, see alignment E=2.5e-55

Best Hits

KEGG orthology group: None (inferred from 36% identity to bge:BC1002_4153)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G6X4 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Echvi_4411 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Echinicola vietnamensis KMM 6221, DSM 17526)
MKSLIKRLVPKGMRNKLKGMAPGNSGGQAVAVPYTIQVSTPGLLKGKVAVVTGGSGAIGR
AICCRLAADGALVVVCGMSHDKMQGVVDEIGANGGKAVKRQLDISSEEKIIEFYQWLKES
YGQLDILVNCAGGSARQASRPIYELETETIDTTLHVNLRGAILVTREASKIMVAAKRGTI
VSVTSVIGEHGKAKFSEYAAAKAGIIAFTKSIAMELGKLGITANCVSPGIVQRGTITPAQ
MAKLKKTNYMNDYGRPEDISEMVAYLTREEGKFITGQNFKVDGGRSLGLKGD