Protein Info for Echvi_4409 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Nucleoside-diphosphate-sugar epimerases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02719: Polysacc_synt_2
  • amino acids 15 to 131 (117 residues), 52.5 bits, E=1.7e-17
• PF01370: Epimerase
  • amino acids 15 to 242 (228 residues), 183.4 bits, E=2e-57
• PF05368: NmrA
  • amino acids 15 to 135 (121 residues), 34.2 bits, E=7.5e-12
• PF01073: 3Beta_HSD
  • amino acids 16 to 240 (225 residues), 78.1 bits, E=2.4e-25
• PF16363: GDP_Man_Dehyd
  • amino acids 16 to 341 (326 residues), 158.2 bits, E=1.6e-49
• PF07993: NAD_binding_4
  • amino acids 17 to 234 (218 residues), 24.7 bits, E=4.9e-09
• PF13460: NAD_binding_10
  • amino acids 19 to 158 (140 residues), 37.7 bits, E=8.4e-13

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• D-galactose degradation I (Leloir pathway) (5/5 steps found)
• colanic acid building blocks biosynthesis (9/11 steps found)
• D-galactose detoxification (3/3 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• stachyose degradation (4/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (3/6 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (3/9 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (10/33 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

See L0G5M5 at UniProt or InterPro

Protein Sequence (362 amino acids)

>Echvi_4409 Nucleoside-diphosphate-sugar epimerases (Echinicola vietnamensis KMM 6221, DSM 17526)
MIGTTEGHQLSGAKVLVTGGAGFIGSNLIDALLEAGSRVVCLDNFSTGKRTNLEKALTSS
RFSLIEGDIRDYTTCAEAVEGCKWVFHQAALGSVPRSIADPMTSTDVNIGGFVKVLFAAK
EAGVQRVVYAASSSTYGDHPDLPKVEHVIGNALSPYAITKYVDELFAKNFADTYGLETIG
LRYFNVFGRRQDPDGAYAAVIPKFVRCLVEGESPRINGDGSFSRDFTYIDNVIQANVKAA
VTGTALMKANLAEYHAHIGRPFNTDAVISEVFNVAFGERVNLNELGSYLKEELSKFDKEI
SGIPMEYGPQRAGDVPHSLASIEKGRKVIGYEPEYSVRQGLGLACEWYWNSFKKERNFEA
DF