Protein Info for Echvi_4397 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Nucleoside-diphosphate-sugar epimerases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF04321: RmlD_sub_bind" amino acids 9 to 67 (59 residues), 27.9 bits, see alignment E=1.8e-10 PF01370: Epimerase" amino acids 10 to 243 (234 residues), 181 bits, see alignment E=4.1e-57 PF16363: GDP_Man_Dehyd" amino acids 43 to 267 (225 residues), 52.6 bits, see alignment E=7.9e-18

Best Hits

Swiss-Prot: 58% identical to COLC_YERPU: GDP-L-colitose synthase (colC) from Yersinia pseudotuberculosis

KEGG orthology group: K02377, GDP-L-fucose synthase [EC: 1.1.1.271] (inferred from 65% identity to sua:Saut_1507)

Predicted SEED Role

"NAD-dependent epimerase/dehydratase family protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.271

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G6G7 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Echvi_4397 Nucleoside-diphosphate-sugar epimerases (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKNKPISRILLTGGSGMVGRNILEYSSLMPYYEIFSPNSKELNLLNKTDVYQYINKTKP
DIIVHAAGKVGGIQANMADPVNFLLENLNMGQNVILGAKENNVKKFLNLSSSCVYPRNAV
NPLQENLILKGELEPTNEGYALAKIFSTKLCEYISKEDPSFLYKTVIPCNLYGKHDKFSP
NNSHMLPAVIRKIDAAKRKGIKKVDIWGDGNSRREFMYAEDLADFIFYALKKLESMPQNL
NVGLGVDYSINEYYETVAKIIGYEGEFFHDLSKPVGMKQKVVDVNRLNEFGWKPSFLLSE
GIKRTYQYFKENYND