Protein Info for Echvi_4341 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: BNR/Asp-box repeat.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF13859: BNR_3" amino acids 171 to 422 (252 residues), 104.9 bits, see alignment E=1.1e-33 PF13088: BNR_2" amino acids 197 to 478 (282 residues), 106.8 bits, see alignment E=2.5e-34 PF02012: BNR" amino acids 344 to 354 (11 residues), 13 bits, see alignment (E = 1.8e-05)

Best Hits

Predicted SEED Role

"Sialidase (EC 3.2.1.18)" in subsystem Galactosylceramide and Sulfatide metabolism or Sialic Acid Metabolism (EC 3.2.1.18)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G4S7 at UniProt or InterPro

Protein Sequence (508 amino acids)

>Echvi_4341 BNR/Asp-box repeat. (Echinicola vietnamensis KMM 6221, DSM 17526)
MGSLLIMMVNCTSRPTGAADVVQVTVNQHTVPVIKGQNNDVLSMEFTLKEGDVLEQISLA
TDGAEELEALTVYELEKGTGGNKEPIAALVRVGEKAVVNMDRPLSPGDHKLVVGIQPKKS
ASLKKTLQIGIKDISFGNSGAAIAKQSGSMPLRLATSLRNAGDDGVAAYRIPGLATTKKG
SLIAVYDIRHNSSVDLQEDIDVGMSRSTDGGENWEPMKTIMDMEEWGGKPQKENGIGDPA
ILVDPANNTIYVVALWLHGKPGERAWFSSGAGMSPDETGQLMMVKSHDDGKTWSDPINIT
RQIKKREWKLMFNGPGKGITMRDGTLVFAGQYKDENDMPYSTLIYSQDQGETWHIGTGAK
ANTTEAQVVELNDGSLMLNMRDNRGGARSVAVTKDLGKTWKEHPSSRSALVEPVCMASLI
TYPENRQSMDASHLFFSNPAVTDGRYNMTIKSSKDEGMSWTKGLLLDEGKGWGYSCLTVI
DKEHLGILYESSQAHMTFQIIRTTELIP