Protein Info for Echvi_4340 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Arylsulfatase A and related enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00884: Sulfatase" amino acids 41 to 321 (281 residues), 158.8 bits, see alignment E=4.1e-50 PF01663: Phosphodiest" amino acids 63 to 270 (208 residues), 29.8 bits, see alignment E=9.6e-11 PF02995: DUF229" amino acids 231 to 277 (47 residues), 26.9 bits, see alignment 4.1e-10 PF16347: SGSH_C" amino acids 279 to 379 (101 residues), 61.6 bits, see alignment E=2.1e-20 amino acids 422 to 463 (42 residues), 29.8 bits, see alignment 1.3e-10

Best Hits

Predicted SEED Role

"Choline-sulfatase (EC 3.1.6.6)" in subsystem Choline Transport or Choline and Betaine Uptake and Betaine Biosynthesis (EC 3.1.6.6)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.1.6.6

Use Curated BLAST to search for 3.1.6.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G6B7 at UniProt or InterPro

Protein Sequence (511 amino acids)

>Echvi_4340 Arylsulfatase A and related enzymes (Echinicola vietnamensis KMM 6221, DSM 17526)
MNKAALTNISGSLWMWFLFMLPMGSCDKKEVNGTGEKRKMNVLLIVSEDNGPELGCYGNQ
EVSTPNIDQLSATGVRFNNAFVTYSVCSPSRSTLFTGLYPHQNGQIGLATHHYQMYDSLK
TLPHYLHGAGYRAGIIGKRHVNPPGAFQWDYEAIKGSNFEKVQLDKYAENALDFIQRDSV
RPYFLMVNFPDAHFPLQKQVEGLPPDPLNAEDVNGSLPFIGVDSKRLREYTANYYNSMAR
LDIAVGWLLKKLEDKGLLENTVIIYMGDHGPQFSRAKCSNYEAGLRVPLIIRHPHRYHHV
GVRNELVSSIDIIPTIMDIVGLRIPESLDGMSLLPLLEQQEPKSKWRDYVFAGGTGSTSM
LFYPRRSVRSDRYKLIQNLLYTRENPKYSFYADHLNGHFAAGTEELELLGATDEVRAAYA
TWKNPPEYELYDLQEDPHEFNNIIDKAKYQSIKDEMIAALRKWQIETDDPFYDQGILDRF
VEEVDSVNQHFPDHSYAKDPSFRWNYLQYFK