Protein Info for Echvi_4329 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Outer membrane receptor proteins, mostly Fe transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 784 signal peptide" amino acids 1 to 14 (14 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 20 to 94 (75 residues), 46.9 bits, see alignment E=5.7e-16 PF13715: CarbopepD_reg_2" amino acids 22 to 106 (85 residues), 50.2 bits, see alignment E=4.2e-17 PF07715: Plug" amino acids 116 to 219 (104 residues), 65.9 bits, see alignment E=8.5e-22 PF00593: TonB_dep_Rec_b-barrel" amino acids 522 to 758 (237 residues), 69.8 bits, see alignment E=8.9e-23

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G4S2 at UniProt or InterPro

Protein Sequence (784 amino acids)

>Echvi_4329 Outer membrane receptor proteins, mostly Fe transport (Echinicola vietnamensis KMM 6221, DSM 17526)
MLLLYQTLLQGNAQEHSAALVGTVRLEAGPPLPGMVIRIAGTQLGTVTDEHGHYGIEGIS
PGKHTVSCNALGYAPQIKEVNFISGRSVSLDFYMAETAQQLGEVTVMGKTESTLLRESSK
AVTVVDTKEAKLQTADLGEVLNTVSGVNVRRSGGLGSENRFSLNGLTDDQIRFMLDGIPL
DIMGYSSGIANVPVNLIERAEIYKGVVPVDLGADALGGAVNLVSNGSSNHGKGAVSYQVG
SFGTHRLSLEAQRKTNAKGFFVRGSGYYDHAKNNYLVDVEIVGDGGKLHDATVPRFHDSY
QSYGLRGTVGLADQKWADEISLEVFANHTARDIQNNNVMSIVYGEVTSRNTNQGALLRYR
KEIAGHLRINFASGYTYDRVNFVDTSRYIYTWTGDVVREADGTPRERSPGELGQATDRLI
WDHVTYARLGMEYQLGANHLLRASSAPTYVSRSGDERWDEENETIDPLHEINTLFTWING
LEHRFNSADEKLENSFFVKHYFQAVRAEEPTSTLEVTRTMDRESNNFGIGTSLRFHLHPR
WMLKASYEWATRLPRSGEIFGNGRLILPNLSLKPERSHNANLAVHFSSSLDAHGPWKLSL
NGFLRGTDQLILLLGNNEVFSYQNVFAARSLGVEFNGSWQSSNKRLQVTANTTVQEFRNR
SPKGDFGPYAGDRIPNRPYFFIHNSVGYHFPELFTHAGNLHLFLKNRYVHAFYKGWESVG
LKKFKAIIPAQFIQHAGATYQMPVKGLKTSLTAEVHNLTNSEVYDFFGVQKPGRAFYLKL
TTSF