Protein Info for Echvi_4326 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 783 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 35 to 106 (72 residues), 46.7 bits, see alignment E=6.6e-16 PF13715: CarbopepD_reg_2" amino acids 36 to 123 (88 residues), 54.8 bits, see alignment E=1.6e-18 PF07715: Plug" amino acids 147 to 237 (91 residues), 46.1 bits, see alignment E=1.2e-15 TIGR01783: TonB-dependent siderophore receptor" amino acids 153 to 767 (615 residues), 237 bits, see alignment E=2.4e-74 PF00593: TonB_dep_Rec_b-barrel" amino acids 341 to 757 (417 residues), 139.3 bits, see alignment E=7e-44

Best Hits

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2T9 at UniProt or InterPro

Protein Sequence (783 amino acids)

>Echvi_4326 TonB-dependent siderophore receptor (Echinicola vietnamensis KMM 6221, DSM 17526)
MNLFLSNSASKGIFIMYIIVLGGTFSSLAQQGQSSVHGKITDNDGLPISYANVYFKELDK
GALSDGKGAFVVEGLPRGNHQLLVSHIGFGKRTVQVALKSGERKDLGKIVLFENGSDLQE
VIVSDRKVNRFADKATEYVARMPLENLENPQVYSVVNKELLQEQVLTDIDQSVRNATGVV
PVVYPSGGFAATFRGFNIGINSRNGMETSTGRSSVDIGNVERIEVLKGPSGTLFGSNVSS
FGGVVNLVTKKPTEDKQTEIGYTTGSFNLHRITADINTPLTRDKKTLFRLNTALNRQKSF
LDYGFNNTFLIAPSLKHIASDRLSLTLDAELFDAKSTRTLYSRYGTNSGITSPEDLLIDY
NKVLFHEDANASTSSLKLFTQAQYRLAANWTSTTLFSYVEEDVDHSYQYYATWLSPGLAA
RNIGNWGPIYNSYTNIQENINGEFATGTVRHKMLVGASLRFMDARSEAATSGFIDTVDVT
TDFRVLRKQELDPYMVAGNWPGWHRANDNTYSVYVSDVLELTDRLSTMLSLRLDHFSRPD
NGAVEGYEQTSLAPKLGLVYQLVKEQVSVFGNYMNGFQNQAPANQPDGALLVLDPLYAEQ
AEGGVKAEVFDKRLTATISYYHIAIDNAVRTNADGFVEQDGRQVSKGGDFEVVANPIAGL
NIVGGYAFNDNRIVKASDEDIEGNKAVGAPENVANLWLSYALQGKLKGLGIGVGGNYVDE
NYLFSDNVVAVPSYTLLNASIFFEQPSWRLGLKGNNLANEKYWSSYGVAQAPANFAANLT
VRF