Protein Info for Echvi_4304 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF00561: Abhydrolase_1" amino acids 31 to 141 (111 residues), 58.3 bits, see alignment E=1.5e-19 PF12697: Abhydrolase_6" amino acids 54 to 245 (192 residues), 34.5 bits, see alignment E=5.4e-12 PF12146: Hydrolase_4" amino acids 57 to 243 (187 residues), 34.8 bits, see alignment E=1.7e-12

Best Hits

KEGG orthology group: K01055, 3-oxoadipate enol-lactonase [EC: 3.1.1.24] (inferred from 52% identity to mlo:mll2481)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G6N1 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Echvi_4304 Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) (Echinicola vietnamensis KMM 6221, DSM 17526)
MVKKNGLDRKYFTTQDGCEIVYKIDGEVTNPVLVLSNSIATDLAMWDGQVEAFCKSYRLL
RFDTRGHGLSESPVGDYSVARLAKDVIELMDYLGIEKAHFCGLSLGGFIGQWLGVHVPHR
LDKLILANTSPYLGPDTIWNENIHLLRNGSDMSHFEELFINGWFPKQMINNQKNRVVPFR
KMILSTSPIGLAGAYAAVRDADFRKTNALIPNKTLILAGEHDQVTKPEHSKLMHEVIRGA
TLKVLPVVHLSNIERINEFERLVLQFLSSP