Protein Info for Echvi_4294 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: AraC-type DNA-binding domain-containing proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF00165: HTH_AraC" amino acids 25 to 63 (39 residues), 44.1 bits, see alignment E=1.6e-15 amino acids 75 to 111 (37 residues), 30.8 bits, see alignment E=2.5e-11 PF12833: HTH_18" amino acids 36 to 114 (79 residues), 73.7 bits, see alignment E=1.2e-24

Best Hits

KEGG orthology group: None (inferred from 50% identity to cpi:Cpin_5964)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G6L0 at UniProt or InterPro

Protein Sequence (151 amino acids)

>Echvi_4294 AraC-type DNA-binding domain-containing proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
METEVYPKVYLYRRIVQAKLFIDIHYADKIDVDNISDEAYFSKFHFIRLFKTIYGKTPHQ
YLKSVRIEKDQQILKKEGISVSEVCTAVGFDSFSSFSTLFKRMTGESPSAYSKRHMETKE
KKDKKPLAFVASCYAYQHGWLENGNFEEVSK