Protein Info for Echvi_4285 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details PF14329: DUF4386" amino acids 29 to 224 (196 residues), 90.2 bits, see alignment E=9.3e-30

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>Echvi_4285 hypothetical protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MYSNKHHNIFGEILIKNFMDNLRKKSITVGILLILGIAVGILSIDPVIDEMGNLESVSIH
SNEILMRAFMQFILALIYASIPIILYTLLKKINTSLTIGFLVFRIISVAFIFIGWLSIRN
RPVSSHFQTLDNLLRSGRDLINHVAMPLILSVGNLMFYSILYQSKLIPRWLSVWGLIATV
LSGILASLLLMFGVIGIITPTYISLAIPTALLEITVAVWLIVKGFDSNVVIFITERNEY