Protein Info for Echvi_4214 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): lysine/tyrosine outer membrane transporter, TonB-dependent receptor component
Rationale: Specifically important in nitrogen source L-Lysine; nitrogen source L-tyrosine disodium salt. Echvi_4214 is a TonB-dependent outer membrane transporter that is required for utilization of lysine. Mutants also have a defect in tyrosine utilization. It probably functions with Echvi_4215, which is cofit and part of a conserved gene cluster. Inner membrane protein Echvi_4216 (PFam PepSY_TM) is also conserved nearby but does not have a phenotype; it may have a regulatory role.
Original annotation: Outer membrane receptor proteins, mostly Fe transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 816 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 34 to 111 (78 residues), 40.1 bits, see alignment E=8.1e-14 PF13715: CarbopepD_reg_2" amino acids 35 to 122 (88 residues), 53.4 bits, see alignment E=4.4e-18 PF07715: Plug" amino acids 137 to 235 (99 residues), 61.5 bits, see alignment E=2.1e-20 PF14905: OMP_b-brl_3" amino acids 595 to 794 (200 residues), 49.8 bits, see alignment E=6e-17

Best Hits

KEGG orthology group: None (inferred from 49% identity to ran:Riean_1688)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G6D2 at UniProt or InterPro

Protein Sequence (816 amino acids)

>Echvi_4214 lysine/tyrosine outer membrane transporter, TonB-dependent receptor component (Echinicola vietnamensis KMM 6221, DSM 17526)
MKTFLPLGKIYFYTALCMLMSGLPAVAQTIPATTLKGRIFDTEESPVPGVIVRIKDSPLT
AISSLDGSYQITDIPEGEVEVLLSCLGYQDHASKVSIEKNKPTVHLDFALEESMTELDGV
IIEGQSVKTEIETKGFAVEVVETDKAALQSVQTNDLLNRTAGIRVRQNGGIGSRVDYNLN
GMSGNSVRIFIDGLPISTYGPSFSLNSIPPALIERIEIYKGVIPAHLADDALGGAINVVL
KKGAVNSLMAAVSYGSFNTLQGNLNAVYRDKRSGFTTKISGFYNYSDNDYEVWGKFVRNI
LPNGRYDYVRAKRFNDSYRSVGGKFDIGFTDVKWADQFFISYTGSDDYNEIQHGTYMSIP
YKGRFTTSQSNVFGLTYSKEDLFTKGLAVNFNGSFSKRAEVVTDTVKWNYNWFGEISLDL
DGEPILRPDGAQQGAPTINHIDRNVSTFRAGAQYELHPQHKLIFGQSFFNIDRFQQDEMR
NAVERQFVGTRDLQKHITSLGYEFNLMHSRLKGNVFGKYYVQNIERMDPILVEGPNGSER
QEDRVTSSRNTTGMGMAYSFRAWKQILFLASAEQAVRMPSEGEIFGSPGDNIVENLSIRP
EISNNLNLGFKLGEFRKNAHEFSFSGSGFIRDTKDKIIQQINPRINDAVQTNPFENLGRT
KAIGFEGQATYSYKKALRATVNFSRFNSVFNTKYDPNGNLYEKFGQQIPNEPYFTINSTL
EYTLKDVFQQGSSLRLSHYFSFVERFYTTWLEIEDFRTPRQYVHDLGATYTLPNQRLSIS
ADLRNVFDKQVYDNFAVQKPGRAFYLKINYAIHNFK