Protein Info for Echvi_4186 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 89 to 254 (166 residues), 45 bits, see alignment E=5.3e-16

Best Hits

KEGG orthology group: None (inferred from 61% identity to gfo:GFO_3027)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2D0 at UniProt or InterPro

Protein Sequence (281 amino acids)

>Echvi_4186 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain (Echinicola vietnamensis KMM 6221, DSM 17526)
MKNIIPATLIFTALLFSCNSKNSGNATNDKTETIVENKTETNSDPLASCSPRVLERNKEN
GLILLTEKQQQELSEKLKQLNPDLPTIGLLMYDNVLTTELTAPMDVFTKLTEDGKQLFNV
ITIAETYDFIVSEEGLKMFPDYILENSPKLDVLIVPSAYDMSLQVKNQNLVDFIKAQNNN
TEYTVSNCAGATLIGESGIADGKKIVTWIGGGEDLQKNYPNLKVQDDGNVSYMEDGKFLS
SNGNLASYISSLELLEKLSSKEHRKFVESYLYLDRLQEWKK