Protein Info for Echvi_4178 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Aldo/keto reductases, related to diketogulonate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF00248: Aldo_ket_red" amino acids 21 to 257 (237 residues), 163.2 bits, see alignment E=3.8e-52

Best Hits

Swiss-Prot: 52% identical to GR_BACSU: Glyoxal reductase (yvgN) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 75% identity to shg:Sph21_0127)

MetaCyc: 52% identical to glyoxal/methylglyoxal reductase (Bacillus subtilis subtilis 168)
Aryl-alcohol dehydrogenase (NADP(+)). [EC: 1.1.1.91]; 1.1.1.91 [EC: 1.1.1.91]; Methylglyoxal reductase (NADPH-dependent). [EC: 1.1.1.91, 1.1.1.283]

Predicted SEED Role

"oxidoreductase, aldo/keto reductase family"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.283 or 1.1.1.91

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5U7 at UniProt or InterPro

Protein Sequence (283 amino acids)

>Echvi_4178 Aldo/keto reductases, related to diketogulonate reductase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKIKLNNGLEMPLLGFGVFQIPDLKECERAVMDAINIGYRLIDTASAYMNEAAVGNAII
KSGVARKELFITSKLWVQDMGYESTKAAFRRTLERLQLDYLDLYLIHQPYGDVFGSWKAM
QELYQAGKIKAIGVANFQPDRVVDLTINSGFAPAINQIETHPFHQQQESHDFLIDHNVQM
QSWGPFAEGKNGIFQNEVLSEIGRKYNKSIAQVILRWLIQRNVIAIPKSVHKERIEENFR
IFDFEISKEDMHSIAALDTGSTLFFDHRNPEMVKWLSETKLDI