Protein Info for Echvi_4170 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: molybdenum cofactor biosynthesis protein A, bacterial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 14 to 335 (322 residues), 336.4 bits, see alignment E=8.3e-105 PF04055: Radical_SAM" amino acids 26 to 184 (159 residues), 123.2 bits, see alignment E=1.2e-39 PF06463: Mob_synth_C" amino acids 190 to 309 (120 residues), 111.8 bits, see alignment E=2.3e-36

Best Hits

Swiss-Prot: 45% identical to CNX2_ARATH: GTP 3',8-cyclase, mitochondrial (CNX2) from Arabidopsis thaliana

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 71% identity to gfo:GFO_0454)

MetaCyc: 45% identical to GTP 3',8'-cyclase (Arabidopsis thaliana col)
RXN-8340 [EC: 4.1.99.22]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2B7 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Echvi_4170 molybdenum cofactor biosynthesis protein A, bacterial (Echinicola vietnamensis KMM 6221, DSM 17526)
MIQRNNTLIKPQIKDRFGRPHTYLRISLTDRCNLRCFYCMPEDRIQLTEKANIMTLEEII
MIAKVYHTLGVNTFRLTGGEPLVRKNLDYLIRELASLGVTLKLTTNGILLDKYLELFKEV
GLKHINISLDTLDQAKALFITKRDYYHRIMSNIQSAVDHGLRVKLNVVLIKGVNDQEIND
FIELTKSNPITVKFIEFMPFKGNKWDWSKGIGQQEILETINQKFKGIEAIDNPKHSTSVN
FRIKDHLGTFGIVSTITNPFCSECNRIRLTADGKMKNCLFANSETDLLGPLRENKNIRDL
ILESIKTKKFSRDGMDEEMESAIYENNRSMISIGG