Protein Info for Echvi_4146 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 PF07992: Pyr_redox_2" amino acids 4 to 319 (316 residues), 188.2 bits, see alignment E=1.2e-58 PF00890: FAD_binding_2" amino acids 5 to 40 (36 residues), 28.1 bits, see alignment 6.3e-10 PF01134: GIDA" amino acids 5 to 68 (64 residues), 23.8 bits, see alignment E=1.1e-08 PF13738: Pyr_redox_3" amino acids 115 to 301 (187 residues), 34.8 bits, see alignment E=5.6e-12 PF00070: Pyr_redox" amino acids 166 to 237 (72 residues), 61.3 bits, see alignment E=5.2e-20 PF02852: Pyr_redox_dim" amino acids 339 to 443 (105 residues), 87.3 bits, see alignment E=4.2e-28

Best Hits

KEGG orthology group: K00383, glutathione reductase (NADPH) [EC: 1.8.1.7] (inferred from 80% identity to mtt:Ftrac_2118)

Predicted SEED Role

"similar to glutathione reductase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G481 at UniProt or InterPro

Protein Sequence (447 amino acids)

>Echvi_4146 Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKYDVIVIGSGMAGMTIANKCAKKGLKTAITDSRPYGGTCALRGCDPKKILVGAAEIIG
RVDKMSGIGISGDISINWEDLMAYKNDFVSKMPKGVEKGYEKAGVKKYHGVASFESENTV
RIGNDLLEGGKIVIATGARPVTLDITGGDLPIDSTDFLNLEKLPEHITFVGGGYIAMEFA
HLAARAGSKITIFHRGERPLENFDEHIVKHLVKATKDLGILLHVETEVIGIEKDGDQFIV
FTKSSNGEQTHHTDLLVNAAGRVPELDGMNLEKASIAYNKKGIEVNEYLQSESNPTVYAA
GDAANSNGLNLTPVAVMEGHAVAANIIRGNSKVPDYTEMPSAVFTLPTLAAVGMTEKQAK
ELDVEYQVKSASASNWYNAKRINESTYAYKVISHKDGHILGAHIIGPHAEEMINLFAMAI
RGKLKVADIRNMVYSYPSMGSDIGSMV