Protein Info for Echvi_4128 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 88 to 113 (26 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 259 to 283 (25 residues), see Phobius details amino acids 295 to 317 (23 residues), see Phobius details amino acids 342 to 362 (21 residues), see Phobius details amino acids 383 to 405 (23 residues), see Phobius details PF03773: ArsP_1" amino acids 8 to 315 (308 residues), 190.6 bits, see alignment E=1.8e-60

Best Hits

KEGG orthology group: K07089, (no description) (inferred from 73% identity to gfo:GFO_2934)

Predicted SEED Role

"PROBABLE INTEGRAL MEMBRANE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G277 at UniProt or InterPro

Protein Sequence (406 amino acids)

>Echvi_4128 Predicted permeases (Echinicola vietnamensis KMM 6221, DSM 17526)
MDNFLKQWGEAAYTSTGFFWMALWAFILGYAVSSFIQIFVTEKRMQETMGDAKAKSILLG
TFFGFISSSCSFSALATSKSLFQKGASFASSIAFLLASTNLVIELGIIISIFLGWQFVVG
EYVGGILLILCSWLLIRLIKPNGLIEKARKNLDSSSDKQAESSSFKEKVQSKKNWAKVGK
QYAMEWKMVWKDVTLGFTIAGIVSAFVPDSFFQTLFINTGEGQNTFGFFTLLEHVIVGPV
AAFLTFIGSMGNIPLAALLFGKGVSFAGVMAFIFSDLIVFPVLRINAKYYGWKMSLFILF
LLFTSLIVTALLLHYGFSFLDFLPDSSGKSITESDHFKIDYTFFLNIAFFIVSGILIYFG
FYKGRDVKYHKEMAPKSPMLEKILKWLAFVCYAWLVTGIFIKMIIL