Protein Info for Echvi_4096 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Bacteroides conjugative transposon TraJ protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 52 to 74 (23 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details TIGR03782: Bacteroides conjugative transposon TraJ protein" amino acids 36 to 335 (300 residues), 300.5 bits, see alignment E=6.3e-94 PF07863: CtnDOT_TraJ" amino acids 286 to 334 (49 residues), 40.6 bits, see alignment 1.7e-14

Best Hits

Predicted SEED Role

"Conjugative transposon protein TraJ" in subsystem Conjugative transposon, Bacteroidales

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G4Q3 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Echvi_4096 Bacteroides conjugative transposon TraJ protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MEMNFMKRTVITAIMAMGLVALPEVSFAQGIGDSVRTLHEVLDDLYTEMLPLAGQLTGVA
RAIAGFGALWFIAYRVWGHMARSESIDVYPLLRPFAIGLAIMLFPAIMDIIHTVGNLIVE
GTALMVHDSNAAINAHIDLLNKQEIVPNITPPADISAPDRYSYPDSVEDMGVLERLANSI
YAFNLQNILNQAISGILQVLFFAAALCINTIRTFQLLVLSILGPIVLGLSVFDGFQHTLS
AWFARYINVFMWLPVANIFGAIIAKIQLNMMVLDQNFLSSTAYMVFMVIAITGYFTVPNV
ASFIVQPGGRDQLLGKTTSIAGQGSKAAVKVGGAIAKSL