Protein Info for Echvi_4084 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: glycine cleavage system H protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 TIGR00527: glycine cleavage system H protein" amino acids 3 to 123 (121 residues), 157.4 bits, see alignment E=9.3e-51 PF01597: GCV_H" amino acids 7 to 123 (117 residues), 143.9 bits, see alignment E=1.2e-46

Best Hits

Swiss-Prot: 68% identical to GCSH_GRAFK: Glycine cleavage system H protein (gcvH) from Gramella forsetii (strain KT0803)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 71% identity to cat:CA2559_01205)

MetaCyc: 50% identical to glycine cleavage system H-protein (Synechocystis sp. PCC 6803)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5K2 at UniProt or InterPro

Protein Sequence (125 amino acids)

>Echvi_4084 glycine cleavage system H protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MDFPKDLKYTKDHEWVKIEGETATIGITEFAQRELGDIVYVEVETVGETIETGEVFGTVE
AVKTVSDLFMPLNGEITEFNEELEGSPELVNDSPYEDGWMIKVKLEGALPDDLLSAEAYA
ELVGE