Protein Info for Echvi_4068 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: isocitrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02924: isocitrate dehydrogenase
  • amino acids 6 to 481 (476 residues), 722.8 bits, E=1.1e-221
• PF00180: Iso_dh
  • amino acids 6 to 337 (332 residues), 317.4 bits, E=1.3e-98
• PF18324: Isocitrate_DH_C_bact
  • amino acids 376 to 487 (112 residues), 147.6 bits, E=1.3e-47

Best Hits

KEGG orthology group: K00031, isocitrate dehydrogenase [EC: 1.1.1.42] (inferred from 60% identity to rce:RC1_0906)

Predicted SEED Role

"Isocitrate dehydrogenase [NADP] (EC 1.1.1.42)" in subsystem TCA Cycle (EC 1.1.1.42)

MetaCyc Pathways

• TCA cycle I (prokaryotic) (8/10 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• cytosolic NADPH production (yeast) (4/5 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (19/26 steps found)
• nitrogen remobilization from senescing leaves (6/8 steps found)
• partial TCA cycle (obligate autotrophs) (6/8 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (6/8 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• superpathway of glyoxylate bypass and TCA (8/12 steps found)
• reductive TCA cycle I (7/11 steps found)
• TCA cycle VII (acetate-producers) (5/9 steps found)
• mixed acid fermentation (10/16 steps found)
• methylaspartate cycle (11/19 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glutathione metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.42

Use Curated BLAST to search for 1.1.1.42

Sequence Analysis Tools

See L0G605 at UniProt or InterPro

Protein Sequence (487 amino acids)

>Echvi_4068 isocitrate dehydrogenase (Echinicola vietnamensis KMM 6221, DSM 17526)
MSSKRKITVAYGDGIGPEIMKATLEILEAAGAQIEPEVIEIGEQVYLKGISSGIEPKAWD
SLRETKIFLKSPITTPQGGGFKSLNVTTRKTLGLYANVRPCKAYSPYIRTHFPETDMVIV
RENEEDLYAGIEHRQTDDVYQCLKLISRPGSEKIIRYAFEYAKKYNRKKVTCMTKDNIMK
LADGLFHKVFNDVAKEYPEIEADHKIIDIGTALIADKPEMFDVIVTLNLYGDIISDVAAQ
ITGSVGLGGSSNVGEDVAMFEAIHGSAPDIAGQNIANPSGLLNGAIMMLVHIGQPEVAEK
VSNAWMKTLEDGIHTGDIYQEGVSSQLVGTKEFAQAVIDRLGQKPEKMVPAEFKKGDGAD
DNMGAIKLADRKPCKKDLIGLDVFIDWKENDRDANVIGDKLRAVDADGLKMQLITNRGVK
VYPDGMKETFCSDHWRVRFFNADQSTITHGQVLDVLKQVEDLGFDFIKTENLYTFDGERG
FSLAQGE