Protein Info for Echvi_4045 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ABC-type transport system involved in resistance to organic solvents, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 151 to 175 (25 residues), see Phobius details amino acids 195 to 221 (27 residues), see Phobius details amino acids 239 to 262 (24 residues), see Phobius details PF02405: MlaE" amino acids 47 to 255 (209 residues), 239.7 bits, see alignment E=1.3e-75

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 72% identity to sli:Slin_1812)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3Y6 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Echvi_4045 ABC-type transport system involved in resistance to organic solvents, permease component (Echinicola vietnamensis KMM 6221, DSM 17526)
MANRSNNREHLISPKIDSMMLGLADAFAFIKRFFKEVWMPPYEFKEVIRQCYKIGYNSLA
LISLTGFIVGIVFTNQSRPSLSEFGATSWLPSLISIAIVRAMGPLVTALIAAGKVGSSIG
AEIGSMKVTEQIDAMEVSATNPFKFLVVTRVLATTFMIPVLVMYTDFVALMGAFLSVNSN
ESVSFSTYFVQVFEAISFLDIFSSILKSLVFGFTIGIVGCYKGYHSSKGTEGVGKAANAS
VVLAMFLIFIEELLALQIVNFIRMS