Protein Info for Echvi_4032 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: amino acid carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 93 to 117 (25 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 244 to 268 (25 residues), see Phobius details amino acids 301 to 328 (28 residues), see Phobius details amino acids 352 to 372 (21 residues), see Phobius details amino acids 392 to 410 (19 residues), see Phobius details amino acids 416 to 436 (21 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 13 to 442 (430 residues), 402.9 bits, see alignment E=8.1e-125 PF01235: Na_Ala_symp" amino acids 55 to 449 (395 residues), 393.8 bits, see alignment E=5.5e-122

Best Hits

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 57% identity to mtt:Ftrac_3788)

Predicted SEED Role

"Sodium/glycine symporter GlyP" in subsystem Glycine cleavage system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1Z0 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Echvi_4032 amino acid carrier protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MGQLIIDFSNWIWGWPLLYLLLGGGTLLFLYSGLIPFRGFGHAMKVVGGKYDDPNAKGDI
TSFQALSSAIAATVGLGNISGVALAIGTGGPGAIFWMWVSAFVGMATKYFTCTLAIMYRG
KDSSGHIQGGPMYVIEEGMGKKWRFLSVIFCVAGIMGLLAIFQANQLTDVIRVVLLKPFG
LDHGTTTRWILGVSMMLLVATVILGGIQRIAAVASKLVPFMVTLYFISVLVILFRFGDEI
LPSFWFILEDAFTGKAVLGGSIGAVIITGARRAAFSNEAGIGTAPMVHGASKNEEPVREG
LIAMLGPFIDTIVVCTLTAMTIMVTGVWETGEKDGVLMTLSAFQSGIPVVGKYFLMAAVL
VFALSTMFTYSYYGHKCFNYLFGADKANYYNYFYLLTIVGGAVVSLKVVMSFVDGMYAVM
AFPTMISAIYLSPKVRAATKDYFRRMKEKNTL