Protein Info for Echvi_4030 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Pirin-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF02678: Pirin" amino acids 62 to 140 (79 residues), 81.6 bits, see alignment E=4.2e-27 PF05726: Pirin_C" amino acids 207 to 309 (103 residues), 74.3 bits, see alignment E=9.5e-25

Best Hits

KEGG orthology group: K06911, (no description) (inferred from 67% identity to kdi:Krodi_0017)

Predicted SEED Role

"Pirin, N-terminal:Pirin, C-terminal"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3X5 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Echvi_4030 Pirin-related protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MKDTAVKKIRQLGFQWQTQDPFLFCAYHLDEFPEGNDDLGPKASLEGRNIGQDFTIKDGW
RMYHGSKVPGFPAHPHKGFETITLVERGFADHSDSLGAAGRFGQGDVQWMTAGKGVMHSE
MFPLLNKEEKNPLLLFQLWLNLPKANKNVPAHFKMLWGETIPVIKEKDANGNDIAIKVIA
GQYGDVKAPAPNPDSWAADPENQVAIWTIKLAPNAKWTLPATAEGINRSLFFYKGEKLEA
EGFEVPEGHSIDLFSEKEITFVNGDQPAELLFLQGKPINEPVVQHGPFVMNSTQEIHQAM
MEFQKTQFGGWPWPNHEPTHPKDKGRFAIHADGREEVKG