Protein Info for Echvi_4028 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Outer membrane receptor for ferrienterochelin and colicins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 787 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 25 to 99 (75 residues), 44 bits, see alignment E=5.8e-15 PF13715: CarbopepD_reg_2" amino acids 34 to 110 (77 residues), 65.7 bits, see alignment E=7.7e-22 PF08308: PEGA" amino acids 59 to 100 (42 residues), 22 bits, see alignment 3e-08 PF07715: Plug" amino acids 119 to 225 (107 residues), 74.6 bits, see alignment E=2.1e-24 PF00593: TonB_dep_Rec_b-barrel" amino acids 307 to 749 (443 residues), 99 bits, see alignment E=1.5e-31

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 60% identity to zpr:ZPR_1570)

Predicted SEED Role

"TonB-dependent receptor; Outer membrane receptor for ferrienterochelin and colicins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5W7 at UniProt or InterPro

Protein Sequence (787 amino acids)

>Echvi_4028 Outer membrane receptor for ferrienterochelin and colicins (Echinicola vietnamensis KMM 6221, DSM 17526)
MKQVITIFLYIFLFHQAVGQDVGSVEGQVDVPNSSTVFASVQVVGTDFGTMTTENGTYEL
HDIPEGNITLKVSLMGFQTVQKTVAVTAGSTTQVNFQLKEDKLNLHEVVISATRYELDRK
EAPVVVNVLNPKLFNATQSVALSEGLNYQPGVRVETNCQNCGFTQVRLNGLEGAYSQILI
NSRAVFSSLNSVYGLDQIPTNIIERVEVVRGGGSALYGSNAIGGTINIITKEPVENTWQI
GSNFSLIDGTTPDNSLNFNGSLTSEDLSTGVTFHGMYRQRGSYDANGDGFTEITRLENNT
FGMKAFLKPNDRSKVSLDFSAIKEYRRGGDHLDLPPHFTDITEELTHNTIIGGLTYDLYS
KDSKNHFSTYISGQKTIRDSYYGGLGGGRTAADSSLAANAYGKTHDLSMVAGSQFSRSFA
HDDVVIFGAEYQLSDVEDEISGYQRLIDQSVHTLGFYGQYEWRPNDRLTALAGGRFDHTV
VDGHYGLSSIVRNVDVSTGVFSPRVNILYDIREDLQFRIGYARGFRAPQAFNEDLHISSV
GGEPTFVILSDELKTELSDAYTTSLNLSNSIGDLQFSFLAEGFYTQLKRPFTTVSTGATL
PNGSILEEVRNGSGAVVRGGNVELNLSPSPKVTVQAGGTLQRSTYHDPQVLFEPEMENEN
EPTVTTEEFLRSPNAHGYLSTNLILTDKLNFDLTGSYTGSMIVPHVVSESGFMELVDSQQ
FFDANIKLAYHFDLIKGFHMELSGGVQNLLNSYQKDFDTGALRDSNYIYGPARPRTFFFG
VKIGDFH