Protein Info for Echvi_4012 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Chloride channel protein EriC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 112 to 128 (17 residues), see Phobius details amino acids 158 to 182 (25 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 236 to 259 (24 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details amino acids 335 to 353 (19 residues), see Phobius details amino acids 358 to 376 (19 residues), see Phobius details amino acids 384 to 409 (26 residues), see Phobius details PF00654: Voltage_CLC" amino acids 91 to 409 (319 residues), 209.6 bits, see alignment E=3.7e-66

Best Hits

KEGG orthology group: None (inferred from 85% identity to cao:Celal_3575)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1X2 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Echvi_4012 Chloride channel protein EriC (Echinicola vietnamensis KMM 6221, DSM 17526)
MKLKQKRKLVRYLDILDQPARFNPFVFSRTFLLWAFLGLIGGIIAGGYWIGLEFLMHKLA
YFTGWQVIPLMAICGLLAGLVIHFIGDPGEIHLIVNNIRFNKGKLDPKNNPSMVLSSLLC
VASGGSLGPEAPLVQVTGSTGTWLGKMLRLKGEELRSLSIAGMASGFTALFGAPLGGSLF
SLEILHHKHAVEYYKAIIPAFVASCFSYLVFALIVHLGLGPTWDLSAYEYSGVFDFGFAV
LFAIIGAAVGWLFIFCTKFLKSAFERKPIPIYIKTLMGGFLLGVIAFYFPITRYFGHHEI
NELLSSDFSLALLFGILAFKIIAIVITVTSGWRGGFIIPLFFVGATMGLIIYQLFPSINL
TLAIVSCMAAINACVTRTPMSTTILLATLTGFGHFIPILFASLTGYFLAPKIPFIGSQMV
KE