Protein Info for Echvi_3962 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Acetyl/propionyl-CoA carboxylase, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 PF00289: Biotin_carb_N" amino acids 4 to 112 (109 residues), 153.3 bits, see alignment E=7.9e-49 PF02786: CPSase_L_D2" amino acids 117 to 324 (208 residues), 264.6 bits, see alignment E=1.5e-82 PF02222: ATP-grasp" amino acids 141 to 282 (142 residues), 35.9 bits, see alignment E=1.5e-12 PF07478: Dala_Dala_lig_C" amino acids 146 to 293 (148 residues), 42.5 bits, see alignment E=1.3e-14 PF02785: Biotin_carb_C" amino acids 338 to 444 (107 residues), 129.3 bits, see alignment E=1.6e-41

Best Hits

Swiss-Prot: 54% identical to PYCA_METJA: Pyruvate carboxylase subunit A (pycA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 67% identity to sli:Slin_3536)

MetaCyc: 54% identical to pyruvate carboxylase subunit A (Methanothermobacter thermautotrophicus Delta H)
Pyruvate carboxylase. [EC: 6.4.1.1]

Predicted SEED Role

"Methylcrotonyl-CoA carboxylase biotin-containing subunit (EC 6.4.1.4)" in subsystem HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism or Serine-glyoxylate cycle (EC 6.4.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.4

Use Curated BLAST to search for 6.4.1.1 or 6.4.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3S1 at UniProt or InterPro

Protein Sequence (499 amino acids)

>Echvi_3962 Acetyl/propionyl-CoA carboxylase, alpha subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MPKIRKILVANRGEIALRIMRTIREMGLKSVAVYSEVDKNAPHVLYADESYCLGPAPSHK
SYLLGERIIEACQALGADAIHPGYGFLSENTAFAKKVADAGLIFIGPSPESIEIMGDKLA
AKKAVSHYDIPMVPGTDHAILDIQEAKKTAVEIGYPILIKASAGGGGKGMRIVQDEGEFE
EQMKRAVSEAQSAFGDGAVFIEKYITSPRHIEIQILADQHGNYLHLFERECSVQRRHQKV
IEEAPSAVVNQEMRKAMGQAAIDVAKACQYYGAGTVEFIVDEALNFYFLEMNTRLQVEHP
VTEMITGKDLVREQIFIAEGQALSFAQDDLTILGHAIETRVYAEDPTNNFLPDIGKLATY
RLPQGPGIRVDDGFREGMEIPIYYDPMIAKLVTFEEDRPKAIQKMVRAIDDYHITGISTT
LSFARFVMLHPAFQSGEFDTKFVEKHFAPSKLAENFSEEEEEILATIAAYLLPNAKQPST
NVNGQDQNNSKWKTRRMNG