Protein Info for Echvi_3936 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Lactate dehydrogenase and related dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 PF00389: 2-Hacid_dh" amino acids 14 to 327 (314 residues), 89.2 bits, see alignment E=2.9e-29 PF02826: 2-Hacid_dh_C" amino acids 108 to 296 (189 residues), 171.7 bits, see alignment E=1.6e-54 PF03446: NAD_binding_2" amino acids 144 to 258 (115 residues), 24.9 bits, see alignment E=2.7e-09

Best Hits

Swiss-Prot: 54% identical to LDHD_ECOLI: D-lactate dehydrogenase (ldhA) from Escherichia coli (strain K12)

KEGG orthology group: K03778, D-lactate dehydrogenase [EC: 1.1.1.28] (inferred from 59% identity to cao:Celal_2963)

MetaCyc: 54% identical to D-lactate dehydrogenase (Escherichia coli K-12 substr. MG1655)
D-lactate dehydrogenase. [EC: 1.1.1.28]

Predicted SEED Role

"D-lactate dehydrogenase (EC 1.1.1.28)" in subsystem Fermentations: Lactate or Fermentations: Mixed acid (EC 1.1.1.28)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.28

Use Curated BLAST to search for 1.1.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G566 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Echvi_3936 Lactate dehydrogenase and related dehydrogenases (Echinicola vietnamensis KMM 6221, DSM 17526)
MKITAFSAHKFEHSYLKEALSDHELKLLEVRLTMDTVDLAAGSDAVAIFVTDNGSRPVLE
KLQQFGVKYLALRSAGFNHVDLSAAEELGLKVARVPEYSPAAIAEHTVALMLALNRKLVK
AHNRVRDLNFSLDGLVGFDMEGKTIGIAGTGKIGSKVAKTLSGFGCRLLAYDPYINESLK
AELEIEYVDFKTLCTESDIITLHLPLSSSSQYMINSSSMEDMKKGVMLINTSRGALVNTK
EVIEALKTGKIGSFGMDVYEEEEDLFFEDHSEDILQDDVIARLLTFQNVLITSHQAFLTK
EALEKIAGVTAFNLNCWAKNESSPHELKGG