Protein Info for Echvi_3928 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF00106: adh_short" amino acids 7 to 189 (183 residues), 177.2 bits, see alignment E=7.1e-56 PF23441: SDR" amino acids 8 to 244 (237 residues), 29 bits, see alignment E=1.7e-10 PF08659: KR" amino acids 10 to 161 (152 residues), 50.1 bits, see alignment E=8.1e-17 PF13561: adh_short_C2" amino acids 15 to 245 (231 residues), 233.2 bits, see alignment E=8e-73

Best Hits

Swiss-Prot: 38% identical to FABG_STAAW: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Staphylococcus aureus (strain MW2)

KEGG orthology group: None (inferred from 78% identity to cps:CPS_1680)

MetaCyc: 34% identical to 1-phenylethanol dehydrogenase subunit (Aromatoleum aromaticum EbN1)
RXN-1302 [EC: 1.1.1.311]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.311

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G4A5 at UniProt or InterPro

Protein Sequence (252 amino acids)

>Echvi_3928 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Echinicola vietnamensis KMM 6221, DSM 17526)
MSHLNGKVAVVTGGNSGIGYSTAKKLKEEGAQVIITGRSAEKVNVAAAELGVTGITADVL
ELAAIDAAVNQVKADFGHVDILFVNAGIFLPAPIGQTTEDLFDQQMDINLKGAVFTIEKF
LPILKDGGSIINLSSINAYTGMPNTSIYGASKAALNSYTRTAATELAPRKIRVNAVNPGP
VYTPIFSKTGMSEDQLNGMAAAMQNRIPLKRYGKPEDIAELVAFLASDRASFITGAEYNI
DGGTNVNPLLVS