Protein Info for Echvi_3909 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Fucose permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 24 to 48 (25 residues), see Phobius details amino acids 60 to 83 (24 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details amino acids 311 to 329 (19 residues), see Phobius details amino acids 335 to 353 (19 residues), see Phobius details amino acids 359 to 376 (18 residues), see Phobius details amino acids 382 to 404 (23 residues), see Phobius details amino acids 416 to 435 (20 residues), see Phobius details amino acids 441 to 461 (21 residues), see Phobius details

Best Hits

KEGG orthology group: K02429, MFS transporter, FHS family, L-fucose permease (inferred from 57% identity to phe:Phep_2311)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1P2 at UniProt or InterPro

Protein Sequence (469 amino acids)

>Echvi_3909 Fucose permease (Echinicola vietnamensis KMM 6221, DSM 17526)
MASVTISKETEDNNVEFDSGQQYLGPLFLVTMLFFMWGFITCMNDILIPHLQQVFTLQNW
QAMLIQTAFFGAYFFISLGYYLISITKGDPIGRIGYKNGIILGLVISAVGCLFFYPAASL
VSFGFFLFALFVLASGITILQIAANPYVTILGKPSGASSRLNMTQAFNSLGTTIAPLIGG
YLIFGAIGDVDISADSVKMPYVALALTLLLIALIFKLFKLPEIGSQGVIISDSGALKHRH
LMLGIGAIFAYVGGEVTVGSNLINFARLPEIAGLDEAEASHYLALFWGGAMVGRFFGAVA
LADFKHNLNRFLIIGAITAISYVTIYYVYGGEMALYALAFIGLNIVVIIIGQFIPNRTLW
LFGITGIGLLVIGLLTSGQLALWSIVALGLFNSIMFPTIFSLAIKGLGKYTAQASSLLVM
AIVGGAIVPLLQGLLADISGSVQLSFLVPLACYLYIVFYGMKGYRVEEG