Protein Info for Echvi_3887 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted hydrolase of the alpha/beta-hydrolase fold

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF12146: Hydrolase_4" amino acids 70 to 280 (211 residues), 40.1 bits, see alignment E=4.2e-14 PF00561: Abhydrolase_1" amino acids 74 to 282 (209 residues), 56.8 bits, see alignment E=4.2e-19

Best Hits

KEGG orthology group: K07019, (no description) (inferred from 45% identity to dsa:Desal_2562)

Predicted SEED Role

"Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1M5 at UniProt or InterPro

Protein Sequence (332 amino acids)

>Echvi_3887 Predicted hydrolase of the alpha/beta-hydrolase fold (Echinicola vietnamensis KMM 6221, DSM 17526)
MTANHENVSILSKMPLITNTSYTGPSVLFNGHLQTIFPALFRKHLSLPFDRERITTPDGD
FLDLDWLRQDSKKLVIICHGLEGDSRRPYMRGMAKHFFQNKYDVLTWNFRGCSGELNIRP
FFYHSGATYDLETVVNHAAEKYAQVYLIGFSLGGNLTLKYLGEPLPKSSKIKKAVAISVP
LHLKSSCTKISSKENLIYSNRFLKTLKVKVQQKALMFPDDLSTDGLQKVKTLKEFDDKFT
GPMHGYRDADHYYDQCSSLYYLDGITIPTLILNAKNDPFLSEECFPVEKAHSLEKVFMEF
PEIGGHVGFTPRKRKEIYWSENRAFEFIDSDA