Protein Info for Echvi_3886 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 2 to 67 (66 residues), 55.9 bits, E=6.1e-19
  • amino acids 125 to 196 (72 residues), 70.1 bits, E=2.3e-23
• TIGR01349: pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  • amino acids 125 to 547 (423 residues), 494.2 bits, E=2.1e-152
• PF02817: E3_binding
  • amino acids 263 to 298 (36 residues), 56.8 bits, 4e-19
• PF00198: 2-oxoacid_dh
  • amino acids 322 to 546 (225 residues), 289.2 bits, E=4.6e-90

Best Hits

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 70% identity to mtt:Ftrac_0743)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 2.3.1.12)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (19/26 steps found)
• pyruvate fermentation to acetate V (2/3 steps found)
• pyruvate fermentation to acetate II (1/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (1/4 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.12

Sequence Analysis Tools

See L0G469 at UniProt or InterPro

Protein Sequence (547 amino acids)

>Echvi_3886 pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form (Echinicola vietnamensis KMM 6221, DSM 17526)
MSDTMEEGVIAAWLKKVGDDVKAGDILAEVETDKATMELESYDEGVLLHIGVEEKDAVPV
NGVIAIIGEKGEDIDDLLKDLDGGGSGDADAAKSEAPAEDKKEESSSEADPSEEIDTSDI
NANLITMPKMSDTMQEGTIASWLKKEGDEVKSGDILAEVETDKATMELESYDDGVLLHIG
VQEGDSVPIDGVIAVIGEKGADYEKLLKAHEQKSNGGSDEKPAAKEEEKKEAPKEASKPA
PKKEETAKQTTSSSSASSDNGRIKASPLAKKLAEDKGVDIALIKGSGEGGRIIKRDVESF
DPASVQPAAQSGVAAPAAVGQESYTEEKVSQMRKTIAKRLAESKFSAPHFYLTMEINMDK
AIEARKSMNEIAPVKISFNDMVIKAVAASLKQHPKVNSSWLGDKIRYNEHVHIGMAVAVE
EGLLVPVIRFADSKTLSQISQEAKTLGGKAKNKELQPKDWEGNTFTISNLGMFGIEEFTA
IVNPPDACILAVGGIKETVIVKDGQMQVGNVMKVTLSCDHRVVDGAVGSGFLKTLKGLLE
DPVRILI