Protein Info for Echvi_3867 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Lactoylglutathione lyase and related lyases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00903: Glyoxalase
  • amino acids 33 to 137 (105 residues), 34.6 bits, E=1.1e-12

Best Hits

KEGG orthology group: None (inferred from 45% identity to rpx:Rpdx1_0904)

Predicted SEED Role

"Lactoylglutathione lyase (EC 4.4.1.5)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 4.4.1.5)

MetaCyc Pathways

• methylglyoxal degradation I (2/3 steps found)
• methylglyoxal degradation VIII (2/3 steps found)
• superpathway of methylglyoxal degradation (5/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.5

Sequence Analysis Tools

See L0G1L1 at UniProt or InterPro

Protein Sequence (145 amino acids)

>Echvi_3867 Lactoylglutathione lyase and related lyases (Echinicola vietnamensis KMM 6221, DSM 17526)
MSLRDLCKFSYIKLNNKKIKRDMAGIRRIVPNIYSDQLEATKVFYLDFLGMEEAMDLGWI
MTFVSKENPLAQINIFEHEGGLPVNNEAVFMSVEVSDVDGMYRKAKQFQYAIVYDIRDES
WGVRRFFVKDPNGATLNILSHLPGK