Protein Info for Echvi_3863 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 PF00534: Glycos_transf_1" amino acids 245 to 396 (152 residues), 28 bits, see alignment E=2.9e-10 PF13692: Glyco_trans_1_4" amino acids 256 to 390 (135 residues), 35.6 bits, see alignment E=2.2e-12 PF13524: Glyco_trans_1_2" amino acids 282 to 403 (122 residues), 27.5 bits, see alignment E=5.6e-10

Best Hits

Predicted SEED Role

"TPR/glycosyl transferase domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5G6 at UniProt or InterPro

Protein Sequence (436 amino acids)

>Echvi_3863 Glycosyltransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MENKNKVLIITYYWPPSAGSGVQRWLKFSKYLPEFGWEPVIFTPENPDFDLKDETMQKEV
SPHWEVIKFPIWEPYGVFRFLKKKKEGKAADPSKLIEKRKKNWFDQTAIWLRANAIVPDP
RVFWVKPSVEFLEEVINKNGIKAIITTGPPHSMHLIGRNLKRKTGLPWIADFRDPWSTWE
FLDTLPMMKSIRKRHEKLERSVFREAEKVVTISPTFQDELQKIAHRDIDLITNGFDSTDL
PSGFKQEKETGGDFEIVYTGIIDAIRNPIPFLKAFKQAFMHAKRGVKLTFVGHVSEKVTH
VIEEDNWLSQHVEFAGYVPHEQVFSFYERADMLLLILTNTKNAKGNIPGKLFEYIATGRT
IIALGDPMGDAAKIISEAGAGRVFSHEAVQEVEAYLSDQANASRSQGGSRDISRFERKTL
TKKLAQLLNEQIDTIS