Protein Info for Echvi_3862 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF01041: DegT_DnrJ_EryC1" amino acids 18 to 360 (343 residues), 338.8 bits, see alignment E=9e-105 PF01212: Beta_elim_lyase" amino acids 25 to 166 (142 residues), 29.1 bits, see alignment E=1.3e-10 PF00266: Aminotran_5" amino acids 48 to 165 (118 residues), 41.7 bits, see alignment E=1.6e-14 PF00155: Aminotran_1_2" amino acids 54 to 130 (77 residues), 24.4 bits, see alignment E=3.2e-09

Best Hits

KEGG orthology group: None (inferred from 41% identity to dsy:DSY3315)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1K7 at UniProt or InterPro

Protein Sequence (366 amino acids)

>Echvi_3862 Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis (Echinicola vietnamensis KMM 6221, DSM 17526)
MSRSIPFLELAPMHRDLADELKAKFAALLEKGLFSGGEEVEVLASSMQEFLKVPYAIPCA
NGTDALELALRALEVGPGDEVIVPALTWVSTAEVVKMVGANLVFCDVDADGLMDLTLLPS
VISPNTKAVIPVHLYGKMMDMKSLAAIAQKTGIKVIEDAAQAFGAFQGGKSAGAYGDIGC
FSFYPTKNLGALGEAGMLTSHDGGLSERLRLLLNHGQPQRDVHELIGRNSRIDTLQAAFL
NVKLSYFTPWQQRRKALAKLYLDHLQHLKGIKVPSSILQENHNAHLFTIQTNQRDALKEC
LSKKGIGTAIHYPLPVPAMKPFGEIDAFPVAARIGKTTLSLPLHPYLREDEVRYVCEEVQ
RFFNKA