Protein Info for Echvi_3855 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Isopropylmalate/homocitrate/citramalate synthases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00682: HMGL-like
  • amino acids 7 to 272 (266 residues), 76.8 bits, E=9.2e-26

Best Hits

KEGG orthology group: K01640, hydroxymethylglutaryl-CoA lyase [EC: 4.1.3.4] (inferred from 60% identity to mtt:Ftrac_0896)

Predicted SEED Role

"Hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4)" in subsystem HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism (EC 4.1.3.4)

MetaCyc Pathways

• L-leucine degradation I (4/6 steps found)
• mevalonate degradation (1/2 steps found)
• ketogenesis (3/5 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Synthesis and degradation of ketone bodies
• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.4

Sequence Analysis Tools

See L0G3I2 at UniProt or InterPro

Protein Sequence (281 amino acids)

>Echvi_3855 Isopropylmalate/homocitrate/citramalate synthases (Echinicola vietnamensis KMM 6221, DSM 17526)
MKIIECPRDAMQGREVFIDTAIKAAYINQLLNVGFDTVDFGSFVSPKAMPQMRDTAEVLD
LLDLFHSKSKLLAIVANVRGAEDAMQFEEIDYLGFPLSISETFQQRNTNKSIQEALEVVA
NLQNMCEVKGRTLVTYLSMGFGNPYGEPFSADLVAEFVGKLDELGVKVIALSDTIGAADP
ALIEEVFKTNTQAYPEIEFGGHFHSRAEHIAEKVEAGLRGGCRRFDGAINGFGGCPMAKD
ELVGNVATEALIEVLEKNGYDLGMNQEEFGEAMKLAKFVFQ