Protein Info for Echvi_3818 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: DNA polymerase III, epsilon subunit and related 3'-5' exonucleases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 PF00929: RNase_T" amino acids 11 to 165 (155 residues), 80.5 bits, see alignment E=3.2e-26 PF20600: ExoX-like_C" amino acids 220 to 246 (27 residues), 40.9 bits, see alignment (E = 1.6e-14)

Best Hits

KEGG orthology group: K02342, DNA polymerase III subunit epsilon [EC: 2.7.7.7] (inferred from 69% identity to mtt:Ftrac_0120)

Predicted SEED Role

"DNA Pol III Epsilon Chain"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5C8 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Echvi_3818 DNA polymerase III, epsilon subunit and related 3'-5' exonucleases (Echinicola vietnamensis KMM 6221, DSM 17526)
MNLNLKSPIAFFDLEATGINISTDRIVEVSIVKVHPGGEEETKTMKINPTIPIPKEVSLI
HGIYDKDIKDAPTFKDVAKELHQFLEGADLAGFNVLKFDIPLLVEEFLRAGIDFDIEKRN
LLDAQKIFHMMEKRNLTAAYKFYCGKTLENAHSAEADTIATYEVFKAQIERYQDEEAFDL
QGNKVGVIENDMKKVHQLINEKMVDLAGRFIFNDEGVECFNFGKHKGKPVEQVLKEEPNY
YDWMMKGDFPLDTKRKFTQIKLRNFNNR