Protein Info for Echvi_3804 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Nucleoside-diphosphate-sugar epimerases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF04321: RmlD_sub_bind" amino acids 1 to 252 (252 residues), 56.3 bits, see alignment E=1e-18 PF16363: GDP_Man_Dehyd" amino acids 4 to 338 (335 residues), 170.1 bits, see alignment E=3.3e-53 PF02719: Polysacc_synt_2" amino acids 4 to 244 (241 residues), 41.8 bits, see alignment E=2.8e-14 PF01073: 3Beta_HSD" amino acids 4 to 301 (298 residues), 74.9 bits, see alignment E=2.1e-24 PF01370: Epimerase" amino acids 4 to 255 (252 residues), 191.5 bits, see alignment E=5.9e-60 PF07993: NAD_binding_4" amino acids 5 to 182 (178 residues), 35.5 bits, see alignment E=2.2e-12

Best Hits

KEGG orthology group: K01795, [EC: 5.1.3.-] (inferred from 66% identity to cpc:Cpar_1802)

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46, 5.1.3.-

Use Curated BLAST to search for 4.2.1.46 or 5.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G4U3 at UniProt or InterPro

Protein Sequence (357 amino acids)

>Echvi_3804 Nucleoside-diphosphate-sugar epimerases (Echinicola vietnamensis KMM 6221, DSM 17526)
MKYLVTGTAGFIGFHVALKLLERGDEVIGVDSINDYYDVNLKYGRLEASGISRHEIGTGK
YVRSAVYGNYTFVKFDLADKALLFELMAANKVDVVIHLAAQAGVRYSLEHPDAYVQANIQ
GFLNVLEACRQYPVKQLVYASSSSVYGANKAMPFSTEHAVDHPVSLYAATKKSNELMAHT
YSHLFGIPTTGLRFFTVYGPWGRPDMAMFLFADAIRKGEVIKVFNYGKMERDFTYIDDIV
EGVVRVADKPRKPNPNWHENPTVSTSYAPYKIYNIGNSKPVKLMDYIHELEKAMGKSAQK
EMMPMQAGDVVCTYADVQDLSADTGYRPATPLEEGVKQFVKWYAAYYKASVPLDEVK