Protein Info for Echvi_3774 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): nitrite transporter, HPP family
Rationale: Specifically detrimental during growth at high nitrite concentrations. Related to Synpcc7942_1745, which is a nitrite transporter (PMID:24904028)
Original annotation: CBS-domain-containing membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details PF04982: TM_HPP" amino acids 22 to 182 (161 residues), 195.8 bits, see alignment E=1.7e-62

Best Hits

KEGG orthology group: None (inferred from 57% identity to fte:Fluta_0160)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G4P6 at UniProt or InterPro

Protein Sequence (208 amino acids)

>Echvi_3774 nitrite transporter, HPP family (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKVQRGYRKARYVVYKQTILNPIDHLWTFIGGFLGIGAIAYIQSELHRFGVLENVFLIG
SFGASAVLVYGATNSPLAQPRNLIFGHTVSAFVGVLVMNTVGNLDIFWLTCAVAVSLAII
AMQILKALHPPGGATALIAVIGTPKIQKLGFLYVLSPVFTGALILLIIALLVNNIPKDRH
YPYNPKVSPYMGRRKKYWLNLQRALGIR