Protein Info for Echvi_3735 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: putative NAD(P)H quinone oxidoreductase, PIG3 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 TIGR02824: putative NAD(P)H quinone oxidoreductase, PIG3 family" amino acids 1 to 324 (324 residues), 453 bits, see alignment E=2.6e-140 PF08240: ADH_N" amino acids 26 to 111 (86 residues), 62.7 bits, see alignment E=5.1e-21 PF00107: ADH_zinc_N" amino acids 152 to 266 (115 residues), 79.1 bits, see alignment E=4.5e-26 PF13602: ADH_zinc_N_2" amino acids 184 to 323 (140 residues), 75 bits, see alignment E=1.7e-24

Best Hits

KEGG orthology group: None (inferred from 62% identity to mtt:Ftrac_2305)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G341 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Echvi_3735 putative NAD(P)H quinone oxidoreductase, PIG3 family (Echinicola vietnamensis KMM 6221, DSM 17526)
MKAVVITEAGGPDVLQVQARDIPNPGPHEVLIKVAASGINRPDVAQRKGLYPAPEDAPAD
IPGLEVSGTISAIGKDVKNWELGDEVCALVAGGGYGEFVTAPAVQCLPIPEGVSLLEAAA
LPETFFTVWNNVFDIGGFQAGQTVLVHGGTSGIGVTAIQMIKALGGKVIVTAGSREKCTF
CQNLGADLAIHYKDEDFEEVIKAHPDFKKVNIILDMVGGDYTAKNIRLLRPKGKLIMINA
MKGRMGEVDLLRIMANQLTLTGSTLRPQSIGYKGHIAKNLQVHVWPFFPEKIKPVIHKVF
PLQEAAKAHQLMESSEHIGKILLQIPVEV