Protein Info for Echvi_3575 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ribulose-phosphate 3-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 TIGR01163: ribulose-phosphate 3-epimerase" amino acids 4 to 214 (211 residues), 284.2 bits, see alignment E=2.6e-89 PF00834: Ribul_P_3_epim" amino acids 5 to 201 (197 residues), 255 bits, see alignment E=1.9e-80

Best Hits

Swiss-Prot: 49% identical to RPE_BACSU: Ribulose-phosphate 3-epimerase (rpe) from Bacillus subtilis (strain 168)

KEGG orthology group: K01783, ribulose-phosphate 3-epimerase [EC: 5.1.3.1] (inferred from 63% identity to chu:CHU_1605)

MetaCyc: 43% identical to ribulose-phosphate 3-epimerase (Escherichia coli K-12 substr. MG1655)
Ribulose-phosphate 3-epimerase. [EC: 5.1.3.1]

Predicted SEED Role

"Ribulose-phosphate 3-epimerase (EC 5.1.3.1)" in subsystem Calvin-Benson cycle or Conserved gene cluster associated with Met-tRNA formyltransferase or Pentose phosphate pathway or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 5.1.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G448 at UniProt or InterPro

Protein Sequence (216 amino acids)

>Echvi_3575 ribulose-phosphate 3-epimerase (Echinicola vietnamensis KMM 6221, DSM 17526)
MDTLIAPSVLAADFANLQSEIELINDSTADLIHVDIMDGVFVPNISFGFPVVDAIKKHAQ
KPLDVHLMIVNPDQYLKAFKAAGAETITVHLEACQHLHRTVQAIHELDCKAGVAINPHTN
VELLRDIIRELDTVIIMSVNPGFGGQEFIEHTYEKVRNLKAIITASGSSAKIEIDGGVNM
ENAYKLIDAGADILVAGSFVFNAEDPKATIAKLKEL