Protein Info for Echvi_3565 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Thiamine monophosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02581: TMP-TENI
  • amino acids 8 to 188 (181 residues), 147.5 bits, E=1.4e-47

Best Hits

Swiss-Prot: 42% identical to THIE_BACV8: Thiamine-phosphate synthase (thiE) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 51% identity to cpi:Cpin_0624)

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (9/10 steps found)
• thiamine diphosphate salvage II (5/5 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiamine diphosphate salvage IV (yeast) (6/7 steps found)
• thiamine diphosphate salvage V (3/3 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate biosynthesis III (Staphylococcus) (2/3 steps found)
• thiamine diphosphate biosynthesis IV (eukaryotes) (2/3 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (5/8 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (4/7 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.3

Use Curated BLAST to search for 2.5.1.3

Sequence Analysis Tools

See L0G440 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Echvi_3565 Thiamine monophosphate synthase (Echinicola vietnamensis KMM 6221, DSM 17526)
MTKINSLHYITPNLDHPKDYLDAIQSYCEAGGKWVQLRMKAFPKAVILRTAFGAKEICQR
YGCSLIINDHPEIAHKSGADGVHVGKKDKSAKDIRECYGDRLLIGATANTLDDILVAAPV
ADYIGLGPLRYTSTKKDLSPILGIDGYQKIIPKSKNIFPHLPIIAIGGIIQDDLPALKAA
RLDGVAISGLLQKSSTPQILIEEIKNTFAYVDHCQ