Protein Info for Echvi_3562 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Aldo/keto reductases, related to diketogulonate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF00248: Aldo_ket_red" amino acids 15 to 290 (276 residues), 194.3 bits, see alignment E=1.3e-61

Best Hits

Swiss-Prot: 48% identical to A1A1B_DANRE: Aldo-keto reductase family 1 member A1-B (akr1a1b) from Danio rerio

KEGG orthology group: K00002, alcohol dehydrogenase (NADP+) [EC: 1.1.1.2] (inferred from 53% identity to abo:ABO_2414)

MetaCyc: 46% identical to aldehyde reductase (Sus scrofa)
Indole-3-acetaldehyde reductase (NADPH). [EC: 1.1.1.191, 1.1.1.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.191 or 1.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G394 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Echvi_3562 Aldo/keto reductases, related to diketogulonate reductase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKSLTFSNGDTMPIIGLGTWQSKPGEVYNAVLKAIEIGYRHFDCAYIYKNEKEIGDAFAK
AFADGTIKREDIWVTSKLWNDSHKPEHVLPALESTLKDLQLDYLDLYLVHWPLALKHGVD
FPEENGDFEHLDNIPLSTTWAAMEGLLETGKVKHIGVSNFKIEKLKEILASAKSKPEVNQ
VEMHPFLPQQGLVDYCKKEGIHLTAYAPLGAAYRTQGQDGVDLPILLENDQVKNIANKLN
ATTAQVVLAWNIQRDIAVIPKSVTPSRIEENFKSNLLTLSQEEMDQLNQLEGPYRFTDGK
LWTTHNSPYELSDFWEEYS