Protein Info for Echvi_3552 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13432: TPR_16" amino acids 26 to 73 (48 residues), 30 bits, see alignment E=3.2e-10 amino acids 92 to 152 (61 residues), 26.8 bits, see alignment E=3.1e-09 amino acids 126 to 168 (43 residues), 18.5 bits, see alignment 1.3e-06 PF13181: TPR_8" amino acids 26 to 45 (20 residues), 12.8 bits, see alignment (E = 6.3e-05) amino acids 55 to 84 (30 residues), 18.6 bits, see alignment 8.8e-07 amino acids 124 to 153 (30 residues), 24.5 bits, see alignment 1.1e-08 PF13414: TPR_11" amino acids 27 to 68 (42 residues), 36.8 bits, see alignment 1.3e-12 amino acids 130 to 168 (39 residues), 27 bits, see alignment 1.6e-09 PF13174: TPR_6" amino acids 124 to 151 (28 residues), 12.6 bits, see alignment 0.00011

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G385 at UniProt or InterPro

Protein Sequence (199 amino acids)

>Echvi_3552 hypothetical protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MIKHSILGLCLCAALFSGCSEKGDSKGDTLFKQGQYQEAIEVYSDRLKTKPKDVEALYSR
GRAYEEVGDLAKAKKDFEAGFKQDDKNLKLLLALSNLYQKEGNHERSLLYAEYATAVPGA
PAMAYFMKARALHQLGNTEEAMKEYTAAIDQDKEFGQAYYYRGVLKYATKKQRSACTDFK
KSASLGYAAAEAAVEKYCQ