Protein Info for Echvi_3547 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ABC-type Mn/Zn transport systems, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF00005: ABC_tran" amino acids 27 to 171 (145 residues), 106 bits, see alignment E=2.5e-34

Best Hits

Swiss-Prot: 57% identical to MNTB_BACSU: Manganese transport system ATP-binding protein MntB (mntB) from Bacillus subtilis (strain 168)

KEGG orthology group: K11710, manganese/zinc/iron transport system ATP- binding protein (inferred from 66% identity to chu:CHU_2026)

Predicted SEED Role

"Manganese ABC transporter, ATP-binding protein SitB" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G380 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Echvi_3547 ABC-type Mn/Zn transport systems, ATPase component (Echinicola vietnamensis KMM 6221, DSM 17526)
MIQQIEHPVVEVHDLMVSYGQNPVLWNIDLTLPAGALIGILGPNGAGKSTLIKAIMGLVE
ANSGYSKLFDQALNQVRNRVSYVPQRESVDWDFPASALDIVMMGTYHHLGLFKRPGKKEK
QLAMDCLEKVNMKAFAKRQISELSGGQQQRVFIARALAQQADIYFMDEPFAGVDMSTEKA
LVELFREMTAGGKTVIVVHHDIYSAGTYFDWLIMLNMHLVASGPTKDVLTEELLTKTYGG
KLSTLTDIGEVIKKSDFNPLKS