Protein Info for Echvi_3541 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: SusD family.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 PF14322: SusD-like_3" amino acids 86 to 226 (141 residues), 57.6 bits, see alignment E=3.3e-19 PF12771: SusD-like_2" amino acids 99 to 205 (107 residues), 29.7 bits, see alignment E=5e-11 PF07980: SusD_RagB" amino acids 318 to 531 (214 residues), 87.3 bits, see alignment E=2.2e-28

Best Hits

KEGG orthology group: None (inferred from 71% identity to lby:Lbys_0107)

Predicted SEED Role

"SusD, outer membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2I7 at UniProt or InterPro

Protein Sequence (533 amino acids)

>Echvi_3541 SusD family. (Echinicola vietnamensis KMM 6221, DSM 17526)
MKFTYKPFQYILTAGILSTGLYSCLDLNEEVYSEVVASNFQPTEKDIPSIIAPVYGSFRG
LMMGWQGYLDTQEESADCIITPARPNGWYDGGTYLRMHQHNWTSLQWQPTNIWQSAYRSI
TTANRVMSQIEDGEIPITDGREAVIAELRATRAFAYYLLLDNHGNVPIVTDFKDVSLPEQ
RSRQEVYDFVVSELQEAMPLLSEDAGATYGQLNKWGVQTLLAKIYLNAEVYTGTAQWEAC
IQACDAVINGNGGYELDDNYADIFNWENHNSPEIIFAVPYDEIYGTGNIVHMKTLDPLSR
FVYNMQAGPWGGNCAVPQFIDTYDPEDGRLKDTWIMGPQYNASTGEMVIDYQKEVPSMDG
TASNDGFRIGKYAIKQGATGSLDNDYPMFRYADVLMMKAEALLRTGRADEAATLVTQVRE
RAFRDAAPSKAQVTGAELMQGSSYEYGIQNEDGSVTGTGGADIPYGRFLDELGWEFAAEA
HRRQDLIRFGVFQTKSWFNHSPHAQAQTRTIFPIPNDEINKNPNLNQNPGYAN