Protein Info for Echvi_3535 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ammonium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 43 to 65 (23 residues), see Phobius details amino acids 77 to 100 (24 residues), see Phobius details amino acids 134 to 158 (25 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details amino acids 205 to 229 (25 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 355 to 376 (22 residues), see Phobius details amino acids 388 to 416 (29 residues), see Phobius details TIGR00836: ammonium transporter" amino acids 42 to 442 (401 residues), 387 bits, see alignment E=5.1e-120 PF00909: Ammonium_transp" amino acids 44 to 442 (399 residues), 338.9 bits, see alignment E=1.9e-105

Best Hits

KEGG orthology group: None (inferred from 64% identity to fjo:Fjoh_1337)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G409 at UniProt or InterPro

Protein Sequence (442 amino acids)

>Echvi_3535 ammonium transporter (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKKWKVAFGTIIAASIAGLFWQVEAPAAGSFGTEDQLVFSDIAWLLTASCLVLLMTPGL
SLFYGGMVGKKNLISTMLQSFISLGVVTMVWTVVGFSLAFGDPIGITIDGQLYGLIGNPF
QYMFFDQVNKLPHISIASSIPFILFALFQMKFAVITPAIITGSFAERVRFIGYVFFIGIF
CVLVYAPLCHMVWHPDGLIGAYFGVLDFAGGTVVHISAGLASLAGALFIGKRRNQHHAPS
NITYIMLGTGMLWFGWFGFNAGSSLAANGTAALAFATTTISSATAMMTWVFFDRMQGRKI
TAMGACIGAVVGLVVITPAAGFITVPESMFFGFIGAIISNLALSAKFLKQMDDTLDVFAC
HGVGGIVGMILTAIFANPEGSSLLHGGWAIFGSHMVVLVGVSVFSFVVSYAIFFVLNKFV
TLRVRDEYEEVGLDISQHGESA