Protein Info for Echvi_3533 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 6-phospho 3-hexuloisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03127: 6-phospho 3-hexuloisomerase
  • amino acids 20 to 195 (176 residues), 204.6 bits, E=5.9e-65
• PF01380: SIS
  • amino acids 44 to 156 (113 residues), 60.5 bits, E=1.5e-20

Best Hits

Swiss-Prot: 49% identical to PHI_MYCGS: 3-hexulose-6-phosphate isomerase (rmpB) from Mycobacterium gastri

KEGG orthology group: K08094, 6-phospho-3-hexuloisomerase [EC: 5.3.1.27] (inferred from 60% identity to zpr:ZPR_1062)

Predicted SEED Role

"6-phospho-3-hexuloisomerase" in subsystem Formaldehyde assimilation: Ribulose monophosphate pathway

MetaCyc Pathways

• formaldehyde assimilation II (assimilatory RuMP Cycle) (9/9 steps found)
• formaldehyde oxidation I (5/6 steps found)
• pentose phosphate pathway (oxidative branch) II (2/2 steps found)

KEGG Metabolic Maps

• Methane metabolism
• Pentose and glucuronate interconversions

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.27

Sequence Analysis Tools

See L0G0M7 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Echvi_3533 6-phospho 3-hexuloisomerase (Echinicola vietnamensis KMM 6221, DSM 17526)
MWNESEMTTENSTISNAITRILSEHEQLFSRIQLENLDDVVQSLHDANRIFLIGAGRTGF
MIKAAAMRLMHLGYTVYVVGETNTPAISNGDLLLAASGSGTTGSIVKAAETARKSGAAVI
SFSTNQDAPLAQLAQHSVIIPAAGKQEFHTSISAQYAGSLFEQSFLILFDGLVHFLWKKS
KTSPEELWTRHANME