Protein Info for Echvi_3532 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 3-hexulose-6-phosphate synthase and related proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00215: OMPdecase
  • amino acids 2 to 202 (201 residues), 137.9 bits, E=2.5e-44

Best Hits

Swiss-Prot: 64% identical to HPS_MYCGS: 3-hexulose-6-phosphate synthase (rmpA) from Mycobacterium gastri

KEGG orthology group: K08093, 3-hexulose-6-phosphate synthase [EC: 4.1.2.43] (inferred from 90% identity to zpr:ZPR_1061)

Predicted SEED Role

"D-arabino-3-hexulose 6-phosphate formaldehyde-lyase (EC 4.1.2.43)" (EC 4.1.2.43)

MetaCyc Pathways

• formaldehyde assimilation II (assimilatory RuMP Cycle) (9/9 steps found)
• formaldehyde oxidation I (5/6 steps found)
• pentose phosphate pathway (oxidative branch) II (2/2 steps found)

KEGG Metabolic Maps

• Methane metabolism
• Pentose and glucuronate interconversions

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.43

Sequence Analysis Tools

See L0G366 at UniProt or InterPro

Protein Sequence (210 amino acids)

>Echvi_3532 3-hexulose-6-phosphate synthase and related proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MTKLQVAIDLLKTADAIALATKVAPYIDIIELGTPLIKSEGLSVITAMKEAFPDKKVFAD
FKTADAGALEAEMAFQAGADYITILGATGDATISGAVEAAKKYNRAVVVDTIGVKDRVKR
AQEVIKLGVEFVELHAGLDEQADPGYSIQVLIDEASRAGVPVSIAGGVNLKSIEAVKKSG
ATVAVAGAAIYGAEDPAAAAKALKEALLAD