Protein Info for Echvi_3523 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF03372: Exo_endo_phos" amino acids 21 to 245 (225 residues), 86 bits, see alignment E=3.2e-28 PF23226: Exo_endo_phos_PGAP2IP" amino acids 38 to 214 (177 residues), 36.2 bits, see alignment E=4e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G0L8 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Echvi_3523 Metal-dependent hydrolase (Echinicola vietnamensis KMM 6221, DSM 17526)
MLPLGWSWDQPDDNGTTLKVMSYNVKYCAPYKSSSPNVDSIANIISHSGADIVFLQEIDR
NTTRSGKVNQLALISEKTGLGYYFYGKAISYQGGETGLGILSRFPLSHQEIHQLPRVELE
GKYVSYRILMTADITVHKQPLTIANTHLELTVENRELQVPAIDSVLTERAHPVILGGDFN
AKPDGPTMTSFFERGYMSSCQEHDRSCFTIPSRNPNRTLDYVLFRPKESFRVLSHEVLQT
EASDHLPLIATFELKSRP